PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ48880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family GATA
Protein Properties Length: 877aa    MW: 89205 Da    PI: 4.2812
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ48880.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA542.3e-17231262132
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                 C+ Cg+t+Tp+WR+gp g+ktLCnaCG++y +
  KXZ48880.1 231 CVECGATQTPQWREGPAGPKTLCNACGVRYGR 262
                 *****************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd043701.09E-934159No hitNo description
SMARTSM004393.4E-435170IPR001025Bromo adjacent homology (BAH) domain
PROSITE profilePS5103815.14735170IPR001025Bromo adjacent homology (BAH) domain
PfamPF014265.9E-536164IPR001025Bromo adjacent homology (BAH) domain
PROSITE profilePS5011412.479225260IPR000679Zinc finger, GATA-type
SMARTSM004011.6E-12225279IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.1E-14228265IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577167.6E-12228266No hitNo description
CDDcd002024.24E-12230260No hitNo description
PROSITE patternPS003440231256IPR000679Zinc finger, GATA-type
PfamPF003208.8E-15231262IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 877 aa     Download sequence    Send to blast
MSSAQVEFFF IGPPLPSTGP TTERLDFAGF SLNGIEYRVG DCAFLFPEDE SQGQHYVAQV  60
LSCFQLTRGQ AADPHCVEVA WFERRSHLDV ADVSGLDDEH NPQSLAKEVV ALEETDVNPI  120
GCISGKALVL KAPCYEEACR MATSCGMDSV DWFFCRGVYK QSEKCIIPFP EFADLLAANN  180
GKRLGKRAKP GLAGQVEVVA DSDDVKRQRF VEEQPAAPMR RTGKLVSGRT CVECGATQTP  240
QWREGPAGPK TLCNACGVRY GRAQQRANKR AVSSGLSRPS CGSGARNGRT SKTSRSEAAP  300
PPRASVRSAA AHAAEETSQR PLRQAALMSA SRTAAYARTG VFPLNSEELE MQLMEGDDGV  360
EVEGVERDAD PPLAVPQAAP LAGGPACRGS SGSGASPHNS SLDASSDSPA QTEPAEAMGP  420
AQAPLEVEVL VDGEADASVA AAAAAAGCPF APLPVLPYQL MPAHAPLLLS PSVFTDSGVV  480
PSAAVDAATA ISFGCETPLP LPPAPVAAAA VGFADAGLMS ALPCVPCDPS AGMIPEAEAD  540
ACAWMSMGLA MADDGAGPCG ADDQLRELQD AAAAADDEEP ALAGPAVSGD GRCASASCAD  600
ASCAHIVSAP VSPSARASCG GADCGLPAGM AGCGSCYGGG GSMSDDMCFY GGCSGVGSLD  660
DDEYTPLVAV EVDFGLGGCM AGSDLFDEVQ LQAGPAAECV PVSGAADLPA LAAAVERYSP  720
DTLAPGTIAR SVLDCLPALL APPEHQQPAA PATAPAQAPL LSEAAVAPLV VLGRQASRAS  780
CEAVAADAAY QAVSQVWEAH QEANRRAREV AAASLGRLNT ALSHLATGSG VDGVLVGAAG  840
APPPTAASHL IDLRDLCGGG MGAYGRDGAE MVVAVRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150GHQ10.0A0A150GHQ1_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2201430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.12e-14GATA transcription factor 9